PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0004s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 304aa    MW: 33992.8 Da    PI: 9.0822
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0004s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.7e-3246103159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +dDgynWrKYGqK+vkgse+prsYY+Ct   Cpv+kkvers  +++++ei+Y+g+Hnhe
  Kalax.0004s0020.1.p  46 VDDGYNWRKYGQKQVKGSEYPRSYYKCTCFCCPVRKKVERSP-EGQIIEIIYKGQHNHE 103
                          59****************************************.***************8 PP

2WRKY106.71.1e-33220278159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYGqK vkg+ +prsYY+Ct++gC+v+k+ver+++dpk v++tYeg+Hnh+
  Kalax.0004s0020.1.p 220 LDDGFRWRKYGQKAVKGNSHPRSYYKCTTPGCNVRKHVERASTDPKSVITTYEGKHNHD 278
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-2839104IPR003657WRKY domain
PROSITE profilePS5081122.99741105IPR003657WRKY domain
SuperFamilySSF1182905.89E-2543104IPR003657WRKY domain
SMARTSM007748.5E-3346104IPR003657WRKY domain
PfamPF031061.8E-2447103IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.3E-36206279IPR003657WRKY domain
SuperFamilySSF1182907.45E-29212279IPR003657WRKY domain
PROSITE profilePS5081135.393215280IPR003657WRKY domain
SMARTSM007744.5E-39220279IPR003657WRKY domain
PfamPF031063.4E-26221278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MQNQAGTGSY KPPSTLEPEI ASIEPPEVFH AGPKSQPPTA ASDKPVDDGY NWRKYGQKQV  60
KGSEYPRSYY KCTCFCCPVR KKVERSPEGQ IIEIIYKGQH NHEQSPPKKS AKDGNDPIEN  120
VRSQAMPDDN QLDKAEVPKR PTEAPPEQIV HEKDEKFLQE TSVDSRPLST DETRGNADSE  180
NGPMLKKRNS GSSVGEPNLP QKTVVEPKIV VQTRSEVDLL DDGFRWRKYG QKAVKGNSHP  240
RSYYKCTTPG CNVRKHVERA STDPKSVITT YEGKHNHDMQ KGRSNGRQHI RRSSPTEITD  300
GGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-3946279876Probable WRKY transcription factor 4
1wj2_A4e-3946279876Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089564.11e-100putative WRKY transcription factor 3
SwissprotQ9ZQ702e-85WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW9QTC51e-100W9QTC5_9R
STRINGVIT_14s0108g01280.t013e-97(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-86WRKY DNA-binding protein 3